DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG31269

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:292 Identity:86/292 - (29%)
Similarity:127/292 - (43%) Gaps:57/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITG 70
            |.|||:  :||...:    |....|........|......||.|||.||....|||:.  |....
  Fly     3 AVVLLI--LLGLSGL----VSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQIS--LQGIS 59

  Fly    71 GAAWCGGTIISDRWIITAAHCTDS-------LTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIV 128
            ||..|||.||::.:::|||||.::       :.||.:.|         .:.|.:...   |.:.:
  Fly    60 GAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY---------NQPGGRYFL---KAIHI 112

  Fly   129 HEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATD 193
            |.::....:.|||:|::|..||.:::..||..||:    .....|:..|.:|||......|...|
  Fly   113 HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL----VPMQPGDEVILTGWGSTVLWGTSPID 173

  Fly   194 I----LQYATVP-------IMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSN 247
            :    |||  ||       :.|:..|.        ..:||..:..|...|:||||||||   .:.
  Fly   174 LQVLYLQY--VPHRECKALLSNDEDCD--------VGHICTFSRLGEGACHGDSGGPLV---SNG 225

  Fly   248 TLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279
            .|:|..::|  ..|..|.|.|...:.:|.|||
  Fly   226 YLVGLVNWG--WPCATGVPDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/250 (30%)
Tryp_SPc 47..282 CDD:238113 76/251 (30%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/250 (30%)
Tryp_SPc 38..258 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.