DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG31205

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:93/256 - (36%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IAEPNQFPYQVGLLLYITGGA--AWCGGTIISDRWIITAAHCT--DSLTTGVDVYLGAHDRTNAK 112
            ||||.:.|:.|.::.....|:  ..|.|.:|..|.::|||||.  |...:...|..|..|.:|  
  Fly    43 IAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSN-- 105

  Fly   113 EEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSD---SYSTYGGE 174
                 |..|..  |.||.|:......||:::|:|...:.|:..:||..||..|:   ...|...:
  Fly   106 -----INLVSA--VTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSK 163

  Fly   175 NAIASGWGKISDSATGATDILQ------YATVPIMNNSGCSPWYFGLVAASNICIKTTGGIS--- 230
            ..:|...|...|....||..|.      |..:.                 |..|.:......   
  Fly   164 LIVAGLEGPSFDRRHSATQRLDKRIKMTYTKID-----------------SKECHEKQARFPEEL 211

  Fly   231 TCNGDSGGPL---VLDDGSNT-----LIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKS 283
            .|......||   .|.:.|.|     |:|....|. ...::...| :..|..:||||.:.|
  Fly   212 ICGHTERSPLSGSALTEASGTPRQFHLLGIAVAGF-FSSDLDHQG-YLNIRPHLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/250 (24%)
Tryp_SPc 47..282 CDD:238113 62/253 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/132 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.