DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and sphinx1

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:246 Identity:68/246 - (27%)
Similarity:110/246 - (44%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGRITGGQIAEPNQFPYQVGLLLY--ITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAH 106
            |.||.||..|:.....|.||::.:  .|....:..|||||::||:|..      |.....|:..|
  Fly    23 SPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVK------TVLKYSYIEVH 81

  Fly   107 DRTNAKEEGQQIIFVETKNVIVHEDWIAETITND--ISLIKLPVPIEFNKYIQPAKLPVKSDSYS 169
            ..:.....|..||.:..:|...|.|       ||  |:|:|.|.. :|::.:...::|.....:.
  Fly    82 LASRRSYRGFDIIRIYKENFRFHYD-------NDHVIALVKCPYQ-KFDRRMDRVRVPAYDTRFE 138

  Fly   170 TYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNG 234
            .|.|...:..|:|.....|. ..:.::...|.:|||:.|:.:|..| ....:|....|....|.|
  Fly   139 RYVGNMTMVCGYGTEKRHAK-LPEWMRCIEVEVMNNTECAKYYTPL-KWYEMCTSGEGFKGVCEG 201

  Fly   235 DSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGV 285
            |.||.:|....:.|.||.. :.:...|.:|:|.|..|::.::.||:..|||
  Fly   202 DIGGAVVTMGPNPTFIGII-WLMPENCSIGYPSVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 62/236 (26%)
Tryp_SPc 47..282 CDD:238113 63/238 (26%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 62/236 (26%)
Tryp_SPc 26..248 CDD:304450 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.