DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and spirit

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:121/265 - (45%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGGAAW-----------CGGTIISDRWIITAAHCTDSLTTGVD 100
            :.||....|.:||:...|        .|           |||.:|::.:::|||||.|       
  Fly   132 VVGGMPTRPREFPFMAAL--------GWRSNFDQRIYYRCGGALIANNFVLTAAHCAD------- 181

  Fly   101 VYLGAHDRTNAKEEGQQIIFVE-----TKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAK 160
              ||....:..:..|..:...|     .:.||:|.|:.|.|..|||:|::|....:  ..::|..
  Fly   182 --LGGEPPSQVRLGGDNLTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTC 242

  Fly   161 LPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPI--MNNSGCSPWY------FGLVA 217
            :..:.:..:|.    ..|.|:|:.|.:...:..:|:   ||:  ::|..|...|      .|::.
  Fly   243 IWTQKEVTNTL----VTAIGYGQTSFAGLSSAQLLK---VPLKSVSNEECQHHYQKDQLAQGVLG 300

  Fly   218 ASNICIKTTGGISTCNGDSGGPLVLDDG-SNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281
            ........||...||.|||||||::.|| ...::|.||.|  .||..|.|.|:||::.::|||| 
  Fly   301 TQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLG--QGCASGPPSVYTRVSSFVDWIE- 362

  Fly   282 KSGVV 286
              |:|
  Fly   363 --GIV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 70/256 (27%)
Tryp_SPc 47..282 CDD:238113 73/259 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 73/262 (28%)
Tryp_SPc 132..361 CDD:214473 70/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.