DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG11664

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:287 Identity:68/287 - (23%)
Similarity:111/287 - (38%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQ---VGLLLY 67
            |.|..|..||.|.||.|                |:.|..|            .|.|   .|.::.
  Fly     3 AVVESLQLILLAIAVRW----------------GDALHRG------------IPVQQQNYGYVMQ 39

  Fly    68 ITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKE-EGQQIIFVETKNVIVHED 131
            |.|......|::.|.|:::|.|||....|...::.:.|..|..|.| .|:|:     ..::.|..
  Fly    40 IYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQV-----AGLLRHPK 99

  Fly   132 WIAETITNDISLIKLPVPIEFN---KYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATD 193
            :...|:.|||:::::...|..:   .||.....|:  ...:.:.....:| ||..:.     ...
  Fly   100 FSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPL--TPLNMFAPPQELA-GWNLMH-----IAQ 156

  Fly   194 ILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIA 258
            .|:..:|.:.....|..| |..::...||...|.|...|.||||.||:        .|....|:|
  Fly   157 PLKSMSVQVEPEKNCRQW-FPQISGGVICASATMGEGLCYGDSGDPLI--------SGGEVCGLA 212

  Fly   259 LG---C-EVGWPGVFTRITYYLDWIEE 281
            :.   | :..:|.:||.:.|:..:|.:
  Fly   213 IAFRKCGDKRYPALFTDVHYHRAFIAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 55/243 (23%)
Tryp_SPc 47..282 CDD:238113 56/246 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/222 (24%)
Tryp_SPc 38..237 CDD:214473 52/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.