DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Cela3b

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:300 Identity:100/300 - (33%)
Similarity:152/300 - (50%) Gaps:44/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL 65
            ::..| ::||:|...|.....:|                   ||.|:..|:.|.|..:|:||. |
  Rat     2 LRLLC-SLLLVALASGCGQPSYN-------------------PSSRVVNGEDAVPYSWPWQVS-L 45

  Fly    66 LYITGGA--AWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEG-QQIIFVETKNVI 127
            .|...|:  ..||||:|:..|::||.||..:..| ..|.||..:|  ..||| :|:|.|...::.
  Rat    46 QYEKDGSFHHTCGGTLIAPDWVMTAGHCISTSRT-YQVVLGEFER--GVEEGPEQVIPVNAGDLF 107

  Fly   128 VHEDWIAETIT--NDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATG 190
            ||..|.:..::  |||:|:||....:....:|.|.||...:...  .|.....||||::|.:.. 
  Rat   108 VHPKWNSNCVSCGNDIALVKLSRSAQLGDTVQLACLPPAGEILP--NGAPCYISGWGRLSTNGP- 169

  Fly   191 ATDILQYATVPIMNNSGCSPW-YFGL-VAASNICIKTTGG--ISTCNGDSGGPL--VLDDGSNTL 249
            ..|.||.|.:|:::.:.||.| ::|. |..:.:|   .||  .|.|||||||||  ..::|:..:
  Rat   170 LPDKLQQALLPVVDYAHCSKWDWWGFSVKKTMVC---AGGDIQSGCNGDSGGPLNCPAENGTWQV 231

  Fly   250 IGATSFGIALGCE-VGWPGVFTRITYYLDWIEEKSGVVNN 288
            .|.|||..:|||. :..|.||||::.:.:||||.  :.||
  Rat   232 HGVTSFVSSLGCNTLKKPTVFTRVSAFNEWIEET--IANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 86/244 (35%)
Tryp_SPc 47..282 CDD:238113 88/246 (36%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 86/244 (35%)
Tryp_SPc 28..265 CDD:238113 88/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.