DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:121/260 - (46%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LPSG----RITGGQIAEPNQFPYQVGL-LLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDV 101
            ||||    .|.||..:.|:..||...| ::...|....|||.:||.::::|||||.....|   |
  Rat    12 LPSGAGAEEIIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHCKGREIT---V 73

  Fly   102 YLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSD 166
            .||||| ...:|..||.|.||.:  |:||.:.:....:||.|:||...:|....:....||..||
  Rat    74 ILGAHD-VRKRESTQQKIKVEKQ--IIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLPSPSD 135

  Fly   167 SYSTYGGENAIASGWGKISDSATGATDILQY----ATVPIMNNSGCSPW-YFGLVAASNICIKTT 226
              ..:.|....|:||||     ||..|...|    ..:.||:...|..: |:..  ...:|:   
  Rat   136 --FIHPGAMCWAAGWGK-----TGVRDPTSYTLREVELRIMDEKACVDYRYYEY--KFQVCV--- 188

  Fly   227 GGISTCN----GDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGVVN 287
            |..:|..    |||||||:.   :....|..|:|..   :...|.:|||::.|:.||   :.|:|
  Rat   189 GSPTTLRAAFMGDSGGPLLC---AGVAHGIVSYGHP---DAKPPAIFTRVSTYVPWI---NAVIN 244

  Fly   288  287
              Rat   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 76/242 (31%)
Tryp_SPc 47..282 CDD:238113 78/244 (32%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 76/242 (31%)
Tryp_SPc 21..242 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.