DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Prss34

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:272 Identity:79/272 - (29%)
Similarity:123/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GETLP----SGR----ITGGQIAEPNQFPYQVGLLLYITGGAAW---CGGTIISDRWIITAAHCT 92
            |.|:|    ||:    |.||.....::||:||.|..|....:.|   |||::|..:|::|||||.
  Rat    17 GSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCV 81

  Fly    93 DSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETIT----NDISLIKLPVPIEFN 153
            :........:.....:....|..|   .::...:|.|..: :|.::    .||:|:||...:..:
  Rat    82 ELKEMEASCFRVQVGQLRLYENDQ---LMKVAKIIRHPKF-SEKLSAPGGADIALLKLDSTVVLS 142

  Fly   154 KYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDI-----LQYATVPIMNNSGCSPWY- 212
            :.:.|..||..|...|:  .:....:|||.|.    |...:     |:...|||:.||.|...| 
  Rat   143 ERVHPVSLPAASQRISS--KKTWWVAGWGVIE----GHRPLPPPCHLREVAVPIVGNSDCEQKYR 201

  Fly   213 --------FGLVAASNICIKTTGGISTCNGDSGGPLVLD-DGSNTLIGATSFGIALGCEV-GWPG 267
                    ..::....:|....|. .:|..|||||||.. :.|...:|..|:||  ||.: .:||
  Rat   202 TYSSLDRTTKIIKDDMLCAGMEGR-DSCQADSGGPLVCRWNCSWVQVGVVSWGI--GCGLPDFPG 263

  Fly   268 VFTRITYYLDWI 279
            |:||:..||.||
  Rat   264 VYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 72/259 (28%)
Tryp_SPc 47..282 CDD:238113 74/256 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 74/256 (29%)
Tryp_SPc 33..275 CDD:214473 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.