DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG18420

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:313 Identity:84/313 - (26%)
Similarity:134/313 - (42%) Gaps:75/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATVLLLATI---LGAQAVDWNSVKNLNIE--TPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL 65
            |::|||.|:   ||       |.:.|:.|  |..|...|.     ||..|::|..|..|:..  .
  Fly     9 ASILLLLTVFPLLG-------STQFLDSECGTRSPLKLGP-----RIVNGKVAVRNSSPWMA--F 59

  Fly    66 LYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDR--TNAKEEGQQIIFVETKNVIV 128
            |:.:.....||||:||.|.::|||||....|| :.|.||.::|  ...:||.|      ......
  Fly    60 LHTSSNQFICGGTLISRRLVLTAAHCFIPNTT-IVVRLGEYNRKLKGYREEHQ------VNRTFQ 117

  Fly   129 HEDWIAETITNDISLIKLPVPIEFNKYIQP------AKLPVKSDSYSTYGGENAIASGWGKISDS 187
            |..:...|..|||:|::|...:.:...|:|      |......||.....|     :|||: ::|
  Fly   118 HRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG-----TGWGR-TES 176

  Fly   188 ATGATDI--LQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLI 250
            ...::::  |..:..|   :..|:   ||.|.::..|...... :.|.||:|||          :
  Fly   177 MHDSSELRTLDISRQP---SKMCA---FGSVLSNQFCAGNWNS-NLCIGDTGGP----------V 224

  Fly   251 GA----------TSFGIAL---GCEVGWPGVFTRITYYLDWIEEKSGVVNNGD 290
            ||          ...|||:   .|:  .|.|||.:..::::| .:..:..||:
  Fly   225 GAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSHIEFI-RRIFLTQNGN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 68/255 (27%)
Tryp_SPc 47..282 CDD:238113 68/257 (26%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 68/255 (27%)
Tryp_SPc 43..267 CDD:238113 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.