DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG33462

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:228 Identity:57/228 - (25%)
Similarity:98/228 - (42%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CGGTIISDRWIITAAHCT-DSLTTGVDVYLGAHDRTNAKEEGQQIIFVE---TKNVIV---HEDW 132
            |.||:|:..:::|||||. |.|.  :.|.||.:: |..|.:....:..|   ..||.:   |..:
  Fly    61 CSGTLINHLFVLTAAHCVPDDLL--ITVRLGEYN-TKTKVDCDNHLCQEPFQEYNVDMGFRHRYY 122

  Fly   133 IAETITNDISLIKLPVPIEFNKYIQPAKL--------PVKSDSYSTYGGENAIASGWGKISDSAT 189
            .|...||||.:::|...:|:..:|:|..:        |:...::.|       .:.|.:.:.:||
  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFT-------TTVWRETAANAT 180

  Fly   190 GATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLV---LDDGSNTLIG 251
              :.:|:...:.......||..|...:....||...|.. ..|:.|||.|.:   ..:||:..: 
  Fly   181 --SKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLS-QLCSTDSGAPQIRKMWHNGSDRYV- 241

  Fly   252 ATSFGIAL----GCEVGWPGVFTRITYYLDWIE 280
              ..|||.    .|:..  |:...:..|.|||:
  Fly   242 --QLGIASRVKGQCQNS--GILMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 55/225 (24%)
Tryp_SPc 47..282 CDD:238113 57/228 (25%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/228 (25%)
Tryp_SPc 48..269 CDD:214473 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.