DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG33461

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:116/278 - (41%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VHGET----------LP--SGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAA 89
            |||.:          :|  |.:|..|..|...::|:...|   .|.....|.|::|:..:::|:|
  Fly    20 VHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL---HTPTYFLCAGSLINQWFVLTSA 81

  Fly    90 HCTDSLTTGVDV----YLGAHDRTN--AKEEGQQIIFVETKNV---IVHEDWIAETITNDISLIK 145
            ||.:.     ||    .||.::|.|  ..|..:.:...:..||   ..|..:..:..:|||.:::
  Fly    82 HCIED-----DVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLR 141

  Fly   146 LPVPIEFNKYIQP------AKLPVKSDSYSTYGGENAIASGWGKIS-DSATGATDILQYATVPIM 203
            |...:|:..:|||      .::.:..|..:.:.     |:|||..| |..|.::.:|....:...
  Fly   142 LERRVEYTYHIQPICIFHHRRMQLVVDQITWFK-----ATGWGLTSTDLNTKSSRVLMELNLYRR 201

  Fly   204 NNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGP---LVLDDGSNTLI--GATSFGIALGCEV 263
            ..:.|:..:.....:..||.....| :.|.||||||   .||..|....:  |..||......:|
  Fly   202 PRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKV 265

  Fly   264 GWPGVFTRITYYLDWIEE 281
               .:.|.:..|..||::
  Fly   266 ---SILTDVVRYGRWIKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/253 (24%)
Tryp_SPc 47..282 CDD:238113 62/256 (24%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/253 (24%)
Tryp_SPc 42..281 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.