DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30323

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:272 Identity:45/272 - (16%)
Similarity:83/272 - (30%) Gaps:113/272 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFV------------- 121
            |...:|.|:::|..|::|:..|..:......      ::.:.::..:.::|.             
  Fly    49 GDNHFCAGSLLSAWWVVTSGCCVSTRPESTP------NQPSNRKNLRVVVFTPKRLKKPSPKNIY 107

  Fly   122 ETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKI-- 184
            ..:.:::.|..|:.  ..:::|:||...:...::..  .||.| :..||:   ...:.|||:|  
  Fly   108 HVQKIVLDESAISG--CTELALLKLDRGVTGQRFAM--MLPEK-ELNSTW---LCNSLGWGRIYY 164

  Fly   185 -----------------SDSATGATD--------------ILQYATVPIMNNSGCSPWYFGLVAA 218
                             .:..|...|              |.:|...|..:...|...|      
  Fly   165 VSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSY------ 223

  Fly   219 SNICIKTTGGISTCNGDSGGPLVL---------------DDG--------------SNTLIGATS 254
                   ||..:.|..|.|.||..               |:|              .:||.||| 
  Fly   224 -------TGRGNMCQQDLGSPLFCDHFLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSGAT- 280

  Fly   255 FGIALGCEVGWP 266
                      ||
  Fly   281 ----------WP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 45/272 (17%)
Tryp_SPc 47..282 CDD:238113 45/272 (17%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 38/252 (15%)
Tryp_SPc 45..272 CDD:214473 38/249 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.