Sequence 1: | NP_648017.1 | Gene: | CG10472 / 38688 | FlyBaseID: | FBgn0035670 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_725729.2 | Gene: | CG30323 / 246539 | FlyBaseID: | FBgn0050323 | Length: | 306 | Species: | Drosophila melanogaster |
Alignment Length: | 272 | Identity: | 45/272 - (16%) |
---|---|---|---|
Similarity: | 83/272 - (30%) | Gaps: | 113/272 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 GGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFV------------- 121
Fly 122 ETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKI-- 184
Fly 185 -----------------SDSATGATD--------------ILQYATVPIMNNSGCSPWYFGLVAA 218
Fly 219 SNICIKTTGGISTCNGDSGGPLVL---------------DDG--------------SNTLIGATS 254
Fly 255 FGIALGCEVGWP 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10472 | NP_648017.1 | Tryp_SPc | 46..279 | CDD:214473 | 45/272 (17%) |
Tryp_SPc | 47..282 | CDD:238113 | 45/272 (17%) | ||
CG30323 | NP_725729.2 | Tryp_SPc | 45..275 | CDD:304450 | 38/252 (15%) |
Tryp_SPc | 45..272 | CDD:214473 | 38/249 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471243 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |