DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30286

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:102/250 - (40%) Gaps:78/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GAAWCGGTIISDRWIITAAHCT-------------DSLTT---------------GVDVYL--GA 105
            |...||||:::.|:|:|||||.             :|||:               .:||..  |.
  Fly    56 GELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGG 120

  Fly   106 HDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQP------AKLPVK 164
            :.|||.                :|          ||.|::|...:|:..:|:|      ..|..|
  Fly   121 YSRTNR----------------IH----------DIGLLRLAKSVEYKVHIKPICLITNTTLQPK 159

  Fly   165 SDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGI 229
            .:..     ...:|:|||:....|  |..||:...|..:|...||..|:.......||:....|:
  Fly   160 IERL-----HRLVATGWGRSPSEA--ANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGV 217

  Fly   230 STCNGDSGGPL---VLDDGSNTL--IGATSFGIALGCEVGWPGVFTRITYYLDWI 279
            | |:||||||:   :..||....  :|..|:|.|   |...|.|||.:..::|||
  Fly   218 S-CSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNA---ECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 67/248 (27%)
Tryp_SPc 47..282 CDD:238113 68/249 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 68/249 (27%)
Tryp_SPc 39..268 CDD:214473 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.