DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30187

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:256 Identity:79/256 - (30%)
Similarity:116/256 - (45%) Gaps:61/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VGLLLYITGG-------AAW-----------CGGTIISDRWIITAAHCTDSLTTGVD-----VYL 103
            :.:.|.||||       :.|           ||||:|..|:::|||||.      ||     |.|
  Fly    30 INIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCI------VDQDVQSVSL 88

  Fly   104 GAHDRTNAKEEGQQIIFVETKNVIVHEDW-IAETITNDISLIKLPVPIEFNKYIQPAKLPV-KSD 166
            ||:::::..:....|      ..:||..: :..:..|||.|:||...:.||..|:|..:.: ||.
  Fly    89 GAYNKSDPADRKDVI------TAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSM 147

  Fly   167 SYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGL---VAASNICIKTTGG 228
            :..........|.|||.:..:.|  :||||  |: |:|:......|..|   .:...||.....|
  Fly   148 ANHMRNMRTFKAFGWGTLRGNKT--SDILQ--TI-ILNHLDREECYMELSVYPSEKQICAGVPSG 207

  Fly   229 ISTCNGDSGGPLVLD---DGSNTLIG--ATSFG-IALG---CEVGWPGVFTRITYYLDWIE 280
             .||.|||||||..|   .|    ||  ...|| |::|   |:  ..||:|.:..:.|||:
  Fly   208 -DTCGGDSGGPLTNDVFIQG----IGNREVQFGIISVGKTSCD--GQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 77/253 (30%)
Tryp_SPc 47..282 CDD:238113 79/256 (31%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/248 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.