DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30090

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:263 Identity:77/263 - (29%)
Similarity:113/263 - (42%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAW-CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRT 109
            :|.||:.|..|..|:    :.||...... ||||:|:.|:::|||||.:. .:.|.|.||.:|.|
  Fly    39 KIIGGRDAIINSNPW----MAYIHSSVKLICGGTLITQRFVLTAAHCVNE-GSAVKVRLGEYDDT 98

  Fly   110 NAKEEGQQII-----------------FVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQ 157
            ..::...:|.                 |.|.||:            |||:|::|...:.|..:|.
  Fly    99 ATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL------------NDIALLRLAKFVTFKAHIS 151

  Fly   158 PAKLPVKS------DSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLV 216
            |..:.:.:      ||...:     :|:|||:.....|  ..:||...:...|:|.|......||
  Fly   152 PICIILGTSKRELVDSIEWF-----VATGWGETRTHRT--RGVLQITQLQRYNSSQCMQALGRLV 209

  Fly   217 AASNICIKTTGGISTCNGDSGGPLV-----LDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYL 276
            ..:.||....|. .||||||||||.     :|.......|..|:|   ..|....||:|.:..|.
  Fly   210 QQNQICAGRLGS-DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG---SRECSGIGVYTDVYSYA 270

  Fly   277 DWI 279
            |||
  Fly   271 DWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/261 (29%)
Tryp_SPc 47..282 CDD:238113 77/262 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 75/261 (29%)
Tryp_SPc 40..276 CDD:238113 77/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.