DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30088

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:117/270 - (43%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTD 93
            |...|...|..|:..:.||..|:.|.....|: :..|.|  .....|||||||.|:|:|||||  
  Fly    27 NFLIPSCGVSYESNVATRIVRGKEAMLKSAPF-MAYLYY--SSEIHCGGTIISSRYILTAAHC-- 86

  Fly    94 SLTTGVDVYLGAHDRTN-----------AKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLP 147
             :...:.|.||.||.|.           ..||...::..:.|.       ....:.|||:|:||.
  Fly    87 -MRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKR-------FDRFLANDIALLKLS 143

  Fly   148 VPIEFNKYIQPAKL---PVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCS 209
            ..|.||.:|||..|   |..:.:...:.     |.|||:  .....:.::||...:...:|..|.
  Fly   144 RNIRFNVHIQPICLILNPAAAPNVHEFQ-----AFGWGQ--TETNHSANVLQTTVLTRYDNRHCR 201

  Fly   210 PWYFGLVAASNICIKTTGGISTCNGDSGGPLVLD---DG--SNTLIGATSFGIALGCEVGWPGVF 269
            ......:..:.:|:...|. .||:||||||||..   ||  ....:|..|||.. .|:.  |||:
  Fly   202 SVLSMPITINQLCVGFQGS-DTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD-KCQS--PGVY 262

  Fly   270 TRITYYLDWI 279
            |.:..|:.||
  Fly   263 TYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 76/251 (30%)
Tryp_SPc 47..282 CDD:238113 77/252 (31%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 76/251 (30%)
Tryp_SPc 45..273 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.