DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG30083

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:248 Identity:77/248 - (31%)
Similarity:119/248 - (47%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGRITGGQIAEPNQFPYQVGLLLYITGGAA--WCGGTIISDRWIITAAHC--TDSLTTGVDVYLG 104
            |.:|..||.||....|:...:..|.....|  .||||:|..:::::||||  .|.:   :.|.||
  Fly    31 SPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQI---LAVRLG 92

  Fly   105 AHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKL---PVKSD 166
            .|..:.        .|..|| ...::.:...:.:|||.::::...::||..|:|..:   |.|..
  Fly    93 EHSSSR--------YFAVTK-AFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVP 148

  Fly   167 SYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGIST 231
            :..|:.     |:||||..:..  .:.:|:...:..:|.|.|....:..|..|.||.....| .|
  Fly   149 NVKTFK-----AAGWGKTENET--FSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDG-DT 205

  Fly   232 CNGDSGGPL---VLDDGS--NTLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279
            |.|||||||   |..|||  ...:|..|||.:| |..  |||:||::.::|||
  Fly   206 CAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 74/244 (30%)
Tryp_SPc 47..282 CDD:238113 76/245 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/244 (30%)
Tryp_SPc 34..255 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.