DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Cela1

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:249 Identity:84/249 - (33%)
Similarity:135/249 - (54%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGRITGGQIAEPNQFPYQVGLLLYITGGAAW---CGGTIISDRWIITAAHCTDSLTTGVDVYLGA 105
            :.|:.||..|..|.:|.|:. |.|::|| :|   ||||:|...|::|||||..|..| ..|.:|.
  Rat    24 NARVVGGAEARRNSWPSQIS-LQYLSGG-SWYHTCGGTLIRRNWVMTAAHCVSSQMT-FRVVVGD 85

  Fly   106 HDRTNAKEEGQQIIFVETKNVIVHEDWIAETIT--NDISLIKLPVPIEFNKYIQPAKLP----VK 164
            |:.  ::.:|.: .:|..:.::||.:|.:..:.  .||:|::|...:..|.|:|.|.||    :.
  Rat    86 HNL--SQNDGTE-QYVSVQKIVVHPNWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVLPQEGTIL 147

  Fly   165 SDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGC-SPWYFG-LVAASNICIKTTG 227
            :::...|      .:|||:...:.. .:..||.|.:|.::.|.| |..|:| .|..:.:|....|
  Rat   148 ANNNPCY------ITGWGRTRTNGQ-LSQTLQQAYLPSVDYSICSSSSYWGSTVKTTMVCAGGDG 205

  Fly   228 GISTCNGDSGGPL-VLDDGSNTLIGATSFGIALGCEVG-WPGVFTRITYYLDWI 279
            ..|.|.||||||| .|.:|..::.|.|||..::||.|. .|.||||::.|:.|:
  Rat   206 VRSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 83/245 (34%)
Tryp_SPc 47..282 CDD:238113 83/246 (34%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 83/244 (34%)
Tryp_SPc 27..262 CDD:238113 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.