DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Cela3a

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:272 Identity:89/272 - (32%)
Similarity:136/272 - (50%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSGRITGGQIAEPNQFPYQVGLLLYITGGA--AWCGGTIISDRWIITAAHCTDSLTTGVDVYLGA 105
            ||.|:..|:.|.|:.:|:||. |.|..||:  ..|||::|:..|::||.||.... ....|.||.
Mouse    24 PSSRVVNGEEAVPHSWPWQVS-LQYEMGGSFHHTCGGSLITPDWVLTAGHCIMPY-LNYRVVLGE 86

  Fly   106 HDRTNAKEEG-QQIIFVETKNVIVHEDWIAETIT--NDISLIKLPVPIEFNKYIQPAKLPVKSDS 167
            |:  :..||| :|:|.:....:.||..|.:|.:.  |:|:|:||....:....:|.|.||...:.
Mouse    87 HE--HGVEEGSEQVIPINAGELFVHPKWNSECVNCGNNIALVKLSRSAQLGDAVQLACLPPAGEI 149

  Fly   168 YSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPW-YFG-LVAASNICIKTTGG-- 228
            ..  .|.....||||::|.:....|. ||.|.:|:::...||.| ::| .|..:.:|   .||  
Mouse   150 LP--NGAPCYISGWGRLSTNGPLPTK-LQQALLPVVDYEHCSRWDWWGHYVKRTMVC---AGGYI 208

  Fly   229 --------------ISTCNGDSGGPL--VLDDGSNTLIGATSFGIALGCE-VGWPGVFTRITYYL 276
                          :|...|||||||  ..|:|:..:.|..||....||. :..|.:|||::.::
Mouse   209 QAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQVHGIASFVSPSGCNTLKKPTMFTRVSAFI 273

  Fly   277 DWIEEKSGVVNN 288
            |||||.  :.||
Mouse   274 DWIEET--IANN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 81/258 (31%)
Tryp_SPc 47..282 CDD:238113 83/260 (32%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 81/258 (31%)
Tryp_SPc 28..279 CDD:238113 83/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.