DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and try-5

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:232 Identity:54/232 - (23%)
Similarity:85/232 - (36%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CGGTIISDRWIITAAHC----------------------------TDS-LTTGVDVYLGA----- 105
            ||||:|:.:.::|||||                            ||| :.|...|.:||     
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRL 137

  Fly   106 ---HDRTNAKEEGQQIIFVETKNVIVHEDWIAETIT------NDISLIKLPVPIEFNKYIQPAKL 161
               :...|.|:.|        |.:.:....|.:...      |||.:::|...|:..:....|.|
 Worm   138 EQKYGCVNEKQNG--------KTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACL 194

  Fly   162 PVKSDSYSTYGGENAIASGWGKISDSATG----ATDILQYATVPIMNNSGCSPWYFGLVAASNIC 222
            |...: .:...|.|..:.|||  ||...|    |..::|..|:.....:.|...:...:...:.|
 Worm   195 PFLPE-VNIQSGANVTSFGWG--SDPGKGFDNAAFPMIQVLTLATETLATCEENWGTSIPFDSFC 256

  Fly   223 IKTTGGISTCNGDSGGPLVL---DDGSNTLIGATSFG 256
            .......:.|:|||||.|..   |.....:|...|:|
 Worm   257 TAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 54/232 (23%)
Tryp_SPc 47..282 CDD:238113 54/232 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 54/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.