DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and try-4

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:286 Identity:72/286 - (25%)
Similarity:116/286 - (40%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAH------------C------------ 91
            |.::...||:.|.   :...|....||:|||...||||||            |            
 Worm    51 QESKIKNFPWAVS---FTVDGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSI 112

  Fly    92 ---------TDSLTTGVDVYLGAHDR--TNAKEEGQQIIFVETKNVIVHEDWIAETIT--NDISL 143
                     |..:..|.....|..|:  .:.:.:...:|..:.:.|:|..::.:....  :|.::
 Worm   113 YRSIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAI 177

  Fly   144 IKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGK---ISDSATGATDILQYATVPIMNN 205
            :::...|.|::.::|..|| :.:.|.|   ::....|||:   .::|.....:|      |:..:
 Worm   178 VEVEKRIHFSENVRPICLP-RPNMYYT---KSLAVPGWGRSYIFNESGPLIHEI------PMRID 232

  Fly   206 SGCS-PWYFGLVA-ASNICIKTTGGIS------TCNGDSGGPLVLDD---GSNTLIGATSFGIAL 259
            ..|. ||...|.| |.:....|:..:|      ||:|||||.|...|   |...||..|||| ..
 Worm   233 RDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFG-TR 296

  Fly   260 GCEVGWPGVFTRITYYLDWIEEKSGV 285
            ||.......|||:..||:.|...:||
 Worm   297 GCPSNMLARFTRVDMYLNLICNYTGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 69/278 (25%)
Tryp_SPc 47..282 CDD:238113 70/281 (25%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 70/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.