DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and try-1

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:246 Identity:73/246 - (29%)
Similarity:114/246 - (46%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHC--TDSLTTGVDVYLGAHDR 108
            |:.||..:.|:.:|:.|.||..:  |...|||::|...:::|||||  .|...|...|.:|.|..
 Worm    57 RLIGGSESSPHSWPWTVQLLSRL--GHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRS 119

  Fly   109 TNAKEEGQQIIFVETKNVIVHEDW--IAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTY 171
            .:....       ....|.:| .|  |....:.|.:::::..|:..:...:|..||      |..
 Worm   120 GSGSPH-------RVTAVSIH-PWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLP------SLP 170

  Fly   172 GGEN--AIASGWGKISDSATGATDILQYATVPIMNNSGCS--PWYFGLV-AASNICI-KTTGGIS 230
            ..||  .:.:|||...:.::.:...|:...||:::...||  |.|.|.: ..|.:|. .:.|.|.
 Worm   171 AVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKID 235

  Fly   231 TCNGDSGGPLV-LDDGSNTLIGATSFGIALGC-EVGWPGVFTRITYYLDWI 279
            :|.|||||||: ..||...|.|..|:||  || ..|.|||:..:.....||
 Worm   236 SCQGDSGGPLMCARDGHWELTGVVSWGI--GCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 71/244 (29%)
Tryp_SPc 47..282 CDD:238113 72/245 (29%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.