DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CTRL

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:240 Identity:80/240 - (33%)
Similarity:127/240 - (52%) Gaps:13/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVD-VYLGAHD 107
            |.||..|:.|....:|:||.  |..:.|..:|||::||..|::|||||  :::.|.. |.||.:|
Human    31 SQRIVNGENAVLGSWPWQVS--LQDSSGFHFCGGSLISQSWVVTAAHC--NVSPGRHFVVLGEYD 91

  Fly   108 RTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYG 172
            | ::..|..|::.|  ...|.|..|.:.|:.||::|:||..|.::...|.|..|...:::.:.  
Human    92 R-SSNAEPLQVLSV--SRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTE-- 151

  Fly   173 GENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSG 237
            |...:.:|||::|.........||...:|::..:.|..::...:..|.||....|. |:|.||||
Human   152 GLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGA-SSCQGDSG 215

  Fly   238 GPLVLDDGSN-TLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281
            ||||...|:. .|||..|:| ...|.|..|.|:||::.:..||.:
Human   216 GPLVCQKGNTWVLIGIVSWG-TKNCNVRAPAVYTRVSKFSTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 77/234 (33%)
Tryp_SPc 47..282 CDD:238113 78/237 (33%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.