DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG43335

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:82/275 - (29%)
Similarity:125/275 - (45%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGL---LLYITGGAAWCGGTIISDRWIITA 88
            |..|.| ||..|     ..||.||..||....|:...|   ..|      :|.||:|::::::||
  Fly    28 NCGIRT-MPSFH-----RTRIIGGSDAEITSHPWMAYLYNEFHY------FCAGTLITNQFVLTA 80

  Fly    89 AHCTDSLTTGVDVYLGAHDRTNAKEEGQQI-IFVETKNV---IVHEDWIAETITNDISLIKLPVP 149
            |||.:: :..:.|.||....|  :.:|... |..|..:|   |.|:.:....:.|||::|:|...
  Fly    81 AHCIEA-SKNLTVRLGGSGLT--RSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLART 142

  Fly   150 IEFNKYIQP--------AKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNS 206
            ::|..:|:|        .:|.::.       |...:|:||| ::|... ...:||.|.:.:||.:
  Fly   143 VKFYDHIRPICIILDPAVRLLLED-------GMTLMATGWG-LADKRM-HPHLLQEAPITVMNRN 198

  Fly   207 GCSPWYFGLVAASNICI--KTTGGISTCNGDSGGPL-----VLDDGSNTLIGATSFGIALGCEVG 264
            .||..|...:....||.  |.|   :||.|||||||     ...|......|.||||   ..|..
  Fly   199 VCSKLYDVAITQGQICAGDKET---NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFG---DIECR 257

  Fly   265 WPGVFTRITYYLDWI 279
            .|.::|.::.|..||
  Fly   258 SPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 74/254 (29%)
Tryp_SPc 47..282 CDD:238113 75/255 (29%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 74/254 (29%)
Tryp_SPc 42..275 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.