DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG43110

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:264 Identity:87/264 - (32%)
Similarity:117/264 - (44%) Gaps:54/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGL-----LLYITGGAAWCGGTIISDRWIITAAH 90
            :||:||          |..|..|......|..|:     ||        ||||||.:.:::|.||
  Fly    30 KTPVPK----------IISGSNASQQSAQYMAGIFNTTHLL--------CGGTIIHEDFVLTVAH 76

  Fly    91 CTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKY 155
            |..:.|  :.|.|||:   |......||..:||   |.|..:...|..|||:|:||...:.||..
  Fly    77 CKSTQT--LFVRLGAY---NINHPTDQIRVIET---IAHPQYSNSTYANDIALVKLERSVIFNLN 133

  Fly   156 IQPAKLPVKSDSYSTYGGE----NAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLV 216
            |||..:.:.    :|.|.:    ||.  |||:..::.  .:||||...|...|...|. .|.|:.
  Fly   134 IQPICIHLD----ATLGKQIRYYNAF--GWGRTRNAE--QSDILQRIFVNRTNPMICH-LYLGMS 189

  Fly   217 A-ASNICIKTTGGISTCNGDSGGPLVLD---DGSN--TLIGATSFGIALGCEVGWPGVFTRITYY 275
            . ...||..|..| .||.|||||||:..   .|.|  |..|.||:|..   |....|::|.::.|
  Fly   190 PDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTR---ECNGVGLYTDVSQY 250

  Fly   276 LDWI 279
            ..||
  Fly   251 SGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 81/247 (33%)
Tryp_SPc 47..282 CDD:238113 83/248 (33%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 82/257 (32%)
Tryp_SPc 36..257 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.