DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG43124

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:87/260 - (33%) Gaps:83/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHC---TDSLTTGVDVYLGAHD 107
            ||.|...|     |:...:|   :.....|.|.:|::.:::|||.|   .:.||    |.||:..
  Fly    33 RINGSSYA-----PWLAEIL---SDSKVICAGALINNLYVLTAASCFKENEKLT----VRLGSGY 85

  Fly   108 RTNAKEEGQQIIFVETKNVIVHEDWIAE---TITNDISLIKLPVPIEFNKYIQP---AKLPVKSD 166
            ...:.|.     |..||...    |:..   ..||::.:.:|...:||..:|:|   .|.| ||.
  Fly    86 FDKSYEN-----FRVTKAYF----WMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSP-KSL 140

  Fly   167 SYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNIC--------- 222
            ..:|                            |..|:|... ..|||........|         
  Fly   141 GLAT----------------------------TFEIINEKP-KMWYFCKNIKGLFCKYVFGENEE 176

  Fly   223 ---IKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGI-ALGCEVGWPGVFTRITYYLDWIEEKS 283
               .|.||...| ...|.||..         |...:|| :......:..|:..:..:::||.:.|
  Fly   177 KWQSKPTGSPWT-ETISNGPFK---------GLVRYGILSYRDNKTYDEVYINVMSHINWIAQIS 231

  Fly   284  283
              Fly   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 53/254 (21%)
Tryp_SPc 47..282 CDD:238113 54/256 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.