DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Ctrl

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:238 Identity:78/238 - (32%)
Similarity:120/238 - (50%) Gaps:13/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVD-VYLGAHDRT 109
            ||..|:.|.|..:|:||.  |....|..:|||::|:..|::|||||  .:|.|.. |.||.:||:
  Rat    33 RIVNGENAVPGSWPWQVS--LQDNTGFHFCGGSLIAPNWVVTAAHC--KVTPGRHFVILGEYDRS 93

  Fly   110 NAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGE 174
            :   ..:.|..:.....|.|..|...|:.||::|:||..|..:...:.|..|  .|.:.:...|.
  Rat    94 S---NAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCL--ASSNEALPAGL 153

  Fly   175 NAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGP 239
            ..:.:|||:||.........||...:|::..:.|..::...:..|.||....|. |:|.||||||
  Rat   154 TCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICAGGAGA-SSCQGDSGGP 217

  Fly   240 LVLDDGSN-TLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281
            ||...|:. .|||..|:|.. .|.|..|.::||::.:..||.:
  Rat   218 LVCQKGNTWVLIGIVSWGTE-NCNVQAPAMYTRVSKFNTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 76/234 (32%)
Tryp_SPc 47..282 CDD:238113 77/237 (32%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 76/234 (32%)
Tryp_SPc 34..260 CDD:238113 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.