DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG42694

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:110/253 - (43%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GETLPSGRITGGQIAEPNQFPYQVGLLLYITGGA-AWCGGTIISDRWIITAAHCTDSLTTGVDVY 102
            |..:.:..||  ::.:|     |.|.|.:|:.|. ..|.|::||.:::::||.|.| :...:.|.
  Fly    28 GAPISNQSIT--KLRQP-----QAGWLAHISNGTHVLCSGSLISKQFVLSAAQCID-VHGKLFVQ 84

  Fly   103 LGAHDRTNAKEEGQQIIFVETKNVIV--HEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKS 165
            ||..:.|.:..      :....||::  |.   .:.:..||.|:||...:::|.::.|..:.:.:
  Fly    85 LGVSNATKSPH------WYTVSNVVIPSHS---GKRLQRDIGLLKLSQSVDYNDFVYPICIALNT 140

  Fly   166 DSYSTYG-GENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGI 229
            ::..... .:|...|.|  :|.:....|.:|..     ::...|.....|.|....||..:....
  Fly   141 NTLDMVKILQNFTTSAW--LSKNKNPQTIVLSQ-----LSRDRCKLNLSGNVTPKEICAASLQRN 198

  Fly   230 STCNGDSGGPLV--LDDGSNTLIGATSFGIALGCEVG--W---PGVFTRITYYLDWIE 280
            ::|..|||..|.  :..||| ::....|||. |...|  |   |.::..:...:.|||
  Fly   199 NSCFIDSGSALTQPIIQGSN-IVREMLFGIR-GYVNGRSWCSEPAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 56/243 (23%)
Tryp_SPc 47..282 CDD:238113 59/245 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 54/228 (24%)
Tryp_SPc 46..253 CDD:214473 51/225 (23%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.