DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and LOC100489516

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002935402.2 Gene:LOC100489516 / 100489516 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:239 Identity:85/239 - (35%)
Similarity:126/239 - (52%) Gaps:16/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAW--CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDR 108
            ||..|:.|.|..:|:||.|    ....:|  |||::|::.|::|||||  .::|...|.||.|||
 Frog    33 RIVNGEEAVPGSWPWQVSL----QDSTSWHFCGGSLINNEWVVTAAHC--GVSTRDKVVLGEHDR 91

  Fly   109 TNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGG 173
            .:..|:.|.:...:   |..|..|.:.||.||||||||..|......:.|..|....:.|.  ||
 Frog    92 NSNVEKIQSLAVAK---VFTHPQWNSNTINNDISLIKLATPAVLGATVAPVCLANIGEDYE--GG 151

  Fly   174 ENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGG 238
            ...:.|||||...:|....::||...:|::.|..|..::...:..:.||....|. |:|.|||||
 Frog   152 RICVTSGWGKTRYNAFTTPNLLQQTALPLLTNDQCKSYWGNNITGTMICAGAAGS-SSCMGDSGG 215

  Fly   239 PLVLD-DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281
            |||.. :.:.||:|..|:|.:: |....|||:.|:|....|::|
 Frog   216 PLVCQANDAWTLVGIVSWGSSM-CATNSPGVYARVTVLRSWVDE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 83/235 (35%)
Tryp_SPc 47..282 CDD:238113 84/238 (35%)
LOC100489516XP_002935402.2 Tryp_SPc 33..256 CDD:214473 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.