DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:294 Identity:83/294 - (28%)
Similarity:135/294 - (45%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKF------ACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFP 59
            |||      |.|.:|.:|..||                 ...|.|....:.:|.||..|....:|
Zfish     1 MKFNSVFCVAGAILLNIAGCLG-----------------QSDVCGRAPLNTKIIGGLNATQGSWP 48

  Fly    60 YQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSL-TTGVDVYLGAHDRTNAKEEGQQIIFVET 123
            :|..:.|..| ...:|||::|:..|::|.|.....: .:.:.||||.  :|.......:|....|
Zfish    49 WQASINLKAT-EEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGR--QTQNGSNPYEISRTVT 110

  Fly   124 KNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSA 188
            | :|.|.::  .::.::::|:||..|:.|:.||:|..|......:  ..|..:..:|||.::..|
Zfish   111 K-IIKHPNY--NSLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVF--VDGTASWVTGWGYLNRPA 170

  Fly   189 T----GATDILQYATVPIMNNSGCSPWYFGLVAASNIC--IKTTGGISTCNGDSGGPLVLDDGSN 247
            |    ...|:||....||:||..|:..|.|::....:|  .....|.:.|.||.|||||:..|: 
Zfish   171 TVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGA- 234

  Fly   248 TLIGATSFGIALG-CEV-GWPGVFTRITYYLDWI 279
              |...|..:..| |.: |:|.::.|::.|.|||
Zfish   235 --IWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 70/241 (29%)
Tryp_SPc 47..282 CDD:238113 72/242 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 70/241 (29%)
Tryp_SPc 36..267 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.