DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and LOC100004427

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:243 Identity:72/243 - (29%)
Similarity:115/243 - (47%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSL-TTGVDVYLG--AHD 107
            :|.||..|....:|:|..:....| |..:|.|::||:||::|||.|...: .:.|.:|||  ..:
Zfish    35 KIVGGLNATEGSWPWQASINFKST-GQFFCSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTN 98

  Fly   108 RTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYG 172
            .:|..|..:.:|.|              ::|.||:|::|...:.|..||:|..|......:  ..
Zfish    99 GSNPYEIPRTVIQV--------------SVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVF--VD 147

  Fly   173 GENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASN-IC---IKTTGGISTCN 233
            |..:..:|||..|.:....:|:|:....||:||..||. ..|:....| ||   :..||. :.|.
Zfish   148 GTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSN-INGITNLDNVICAGFVNETGK-APCW 210

  Fly   234 GDSGGPLVLDDGSNTL-IGATSFGIALGC-EVGWPGVFTRITYYLDWI 279
            .|.|.|||...||..: .|...|..   | :.|:|.::.|::.|.:||
Zfish   211 EDFGSPLVTRQGSQWIQSGVVVFTF---CGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 70/241 (29%)
Tryp_SPc 47..282 CDD:238113 72/242 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 70/241 (29%)
Tryp_SPc 36..257 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.