DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Plg

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_445943.1 Gene:Plg / 85253 RGDID:619893 Length:812 Species:Rattus norvegicus


Alignment Length:248 Identity:83/248 - (33%)
Similarity:125/248 - (50%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRA---LVFLGANEI 183
            |:.||.|.|||.:|:|:. |..|..|.::|||:|||.:.|:|||||::.:.|.   .|.|||:|.
  Rat   581 RVVGGCVANPHSWPWQIS-LRTRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEE 644

  Fly   184 KNAKEKGQVRLMVPSENFQIYPTWNPKRLKD-DIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFK 247
            :          ::.|:..||..|.......| |||:::|....:..:.:.|..||..:|....  
  Rat   645 R----------ILGSDVQQIAVTKLVLEPNDADIALLKLSRPATITDNVIPACLPSPNYVVAD-- 697

  Fly   248 NKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYR--GTNICTSGRNAR--STCN 308
            ..|...:|||. ..|...... |:..||.:|:.:.|.....|:.|  .|.:| :|..|.  .:|.
  Rat   698 RTLCYITGWGE-TKGTPGAGR-LKEAQLPVIENKVCNRAEYLNNRVKSTELC-AGHLAGGIDSCQ 759

  Fly   309 GDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWISDE 360
            ||||||||...:  .|.:|.|:||:|  .||.| ..|..:.:|:.|::||..|
  Rat   760 GDSGGPLVCFEK--DKYILQGVTSWG--LGCARPNKPGVYVRVSRYVNWIERE 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 80/243 (33%)
Tryp_SPc 123..359 CDD:238113 81/244 (33%)
PlgNP_445943.1 PAN_AP_HGF 33..97 CDD:238532
KR 101..183 CDD:214527
KR 183..262 CDD:214527
KR 273..354 CDD:214527
KR 374..456 CDD:214527
KR 480..562 CDD:214527
Tryp_SPc 581..805 CDD:214473 80/243 (33%)
Tryp_SPc 582..807 CDD:238113 81/244 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.