DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Tmprss6

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:243 Identity:78/243 - (32%)
Similarity:123/243 - (50%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV---DMAKRAL--VFLGAN 181
            ||.||.|.:...:|:|..:.:   :|.:.|||:||:|:.|||||||.   .||...|  ||||..
Mouse   576 RIVGGTVSSEGEWPWQASLQI---RGRHICGGALIADRWVITAAHCFQEDSMASPKLWTVFLGKM 637

  Fly   182 EIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSF 246
            . :|::..|:|...| |..| ::|.........|:|:::|.|.|.::..:.|:.||.|.:.:...
Mouse   638 R-QNSRWPGEVSFKV-SRLF-LHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPG 699

  Fly   247 KNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNA-RSTCNGD 310
            ::  ...:|||....| ..:||.|:.|.:|::....|...:........:|...|.. :..|.||
Mouse   700 QH--CWITGWGAQREG-GPVSNTLQKVDVQLVPQDLCSEAYRYQVSPRMLCAGYRKGKKDACQGD 761

  Fly   311 SGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            ||||||. |..|.:..|.|:.|:|  .||.| .:...:|:|...::||
Mouse   762 SGGPLVC-REPSGRWFLAGLVSWG--LGCGRPNFFGVYTRVTRVINWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 76/241 (32%)
Tryp_SPc 123..359 CDD:238113 77/242 (32%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 76/241 (32%)
Tryp_SPc 577..809 CDD:238113 77/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.