DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Gzmn

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_038949596.1 Gene:Gzmn / 691668 RGDID:1597226 Length:465 Species:Rattus norvegicus


Alignment Length:338 Identity:97/338 - (28%)
Similarity:142/338 - (42%) Gaps:45/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GPAGLSTSSSSPFSSSGSLEH-------DAE--------MSASNV---DNRHIKGLGMGREMSA- 89
            |.||...:|.:....|..||.       |||        ...:.:   |...|:....|...|| 
  Rat   144 GVAGWGKTSINANKGSALLEEAELIIQGDAECKKRFRHYSETTEICAGDPNEIEAPSKGCVCSAL 208

  Fly    90 --LSEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG-LYWC 151
              ||....:.|.||.|.|.     :||..|.| :.|.||....||.:||...:...:..| :.:|
  Rat   209 LHLSRLPGKMPPVLILLTL-----LLPLEAGA-EEIIGGHEVKPHSYPYMAFIQSVKADGNISYC 267

  Fly   152 GGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDI 216
            ||.|:.|..|:|||||  ..:...|.|||:.|| |||..|..:.|  |....:|.:|......||
  Rat   268 GGFLVQDYFVLTAAHC--EGESMTVMLGAHNIK-AKEDTQQIISV--EKAISHPAYNKVDYSYDI 327

  Fly   217 AIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGR 281
            .:::|.......:.:..:.||:...:.:  ...:...:|||..:.....:|:.||..:|.|.:.:
  Rat   328 MLLKLKSKAKRTKAVSTLMLPQSDAQVK--PGDVCHVAGWGLTSINGTKVSSCLREAELIIQEDQ 390

  Fly   282 TCKSNFPLSYRGTNICTSG-RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPA 345
            .|:..|...::...||... .|.:....||||||||...|      ..|:.::|.......|   
  Rat   391 ECEKIFYNYFKTIQICAGDPNNVQDASKGDSGGPLVCDNR------AYGVIAYGKKGEISSG--- 446

  Fly   346 AFTKVASYLDWIS 358
            .||||..:|.|||
  Rat   447 VFTKVVYFLPWIS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/236 (29%)
Tryp_SPc 123..359 CDD:238113 71/238 (30%)
GzmnXP_038949596.1 Tryp_SPc 21..>194 CDD:238113 11/49 (22%)
Tryp_SPc 238..461 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.