DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and ST14

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:258 Identity:74/258 - (28%)
Similarity:120/258 - (46%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV--DMAKRA------LVFL 178
            |:.||...:...:|:||. |....:| :.||.||||...:::||||.  |...|.      ..||
Human   614 RVVGGTDADEGEWPWQVS-LHALGQG-HICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFL 676

  Fly   179 GANEIKNAKEKG-QVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYE 242
            |.::.......| |.|.:   :....:|.:|......|||::.|.....::..:.||.||...:.
Human   677 GLHDQSQRSAPGVQERRL---KRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHV 738

  Fly   243 YRSFKNKLAIASGWG--RYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICT---SGRN 302
            :.:  .|....:|||  :|. |..|:  :|:..::::|:..||::..|.......:|.   ||  
Human   739 FPA--GKAIWVTGWGHTQYG-GTGAL--ILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSG-- 796

  Fly   303 ARSTCNGDSGGPLVLQRRHSKKRVL-VGITSFGSIYGC-DRGYPAAFTKVASYLDWISDETGV 363
            ...:|.||||||  |....:..|:. .|:.|:|.  || .|..|..:|::..:.|||.:.|||
Human   797 GVDSCQGDSGGP--LSSVEADGRIFQAGVVSWGD--GCAQRNKPGVYTRLPLFRDWIKENTGV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/250 (28%)
Tryp_SPc 123..359 CDD:238113 70/251 (28%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.