DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG18754

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:276 Identity:63/276 - (22%)
Similarity:111/276 - (40%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV 168
            :|||:..          ||  |.:....:.:|:.|.:|.:....|.         ::|:||||||
  Fly    99 QTTPVFR----------DR--GAENAELNEYPWMVLLLYENRLSLI---------RYVLTAAHCV 142

  Fly   169 DMAKRALVFLGANEIKNAKEKGQVRL------MVPSEN--------------FQIYPTWNPKRLK 213
                     :|....:|......|||      .:.||:              .|.: |.:....:
  Fly   143 ---------IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGF-TSSGGTYR 197

  Fly   214 DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQII 278
            :|||::||...|.:.::|.||.|....:..:....::   |||....:....|::.::  :....
  Fly   198 NDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQI---SGWDPTKSSQTLITSTVK--ERNPA 257

  Fly   279 DGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDR 341
            |   |.:.:|.....:.:|..|:....||.|.||.|:  ::.....:...|.||.|:|..|....
  Fly   258 D---CLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSA 319

  Fly   342 GYPAAFTKVASYLDWI 357
            |.|..:||:..:.:||
  Fly   320 GIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 57/256 (22%)
Tryp_SPc 123..359 CDD:238113 58/257 (23%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 58/255 (23%)
Tryp_SPc 108..335 CDD:214473 56/253 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.