DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG34171

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:263 Identity:66/263 - (25%)
Similarity:110/263 - (41%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 HCFPYQVGM----LLQRPKGLYWCGGSLISDKHVITAAHCVD-------MAKRALVFLGANEIKN 185
            |...|.|.:    .:..|...::|.|.:::::||:|:|||:.       ..||.:|.|.|:..|.
  Fly    34 HLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKT 98

  Fly   186 AKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFN-ERIHPIQLPKRHYEYRSFKNK 249
            .:.:   ..:|...|..|:|.:: :...:||||::|...|..: ..:.|:.|.....|..:....
  Fly    99 PESE---EFVVDIHNMIIHPYYH-RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKT 159

  Fly   250 LAIASGWGRYATG-VHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN---ICTSGRNARSTCNGD 310
            :....|..|...| .|  |.:|..|:|:..|.........::.|..|   ||... ..:..|..|
  Fly   160 IGGIFGVRRQRFGSFH--SMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKS-TEKQMCTTD 221

  Fly   311 SGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAHQDTTEAIFF 375
            .||||....:      |.|| :.||| .|....|..|:.|:.|..|::..  :|...|.|.....
  Fly   222 FGGPLFCDGQ------LYGI-ALGSI-NCSSPDPVFFSDVSFYNSWVTKI--ISEAVDHTRPFIA 276

  Fly   376 DQY 378
            |::
  Fly   277 DRF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 61/240 (25%)
Tryp_SPc 123..359 CDD:238113 62/242 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 61/240 (25%)
Tryp_SPc 38..263 CDD:304450 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.