DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and PROC

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:244 Identity:73/244 - (29%)
Similarity:120/244 - (49%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186
            |:..|.:......|:|| :||...|.|. ||..||....|:|||||:|.:|:.||.||..:::. 
Human   326 RLIDGKMTRRGDSPWQV-VLLDSKKKLA-CGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRR- 387

  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFK--NK 249
            .||.::.|.: .|.| ::|.::.....:|||::.|....:.::.|.||.||......|...  .:
Human   388 WEKWELDLDI-KEVF-VHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQ 450

  Fly   250 LAIASGWGRYATGVHAISN----VLRYVQLQIIDGRTCKSNFPLSYRGTNICTSG--RNARSTCN 308
            ..:.:|||.:::.......    ||.::::.::....| |....:....|:..:|  .:.:..|.
Human   451 ETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNEC-SEVMSNMVSENMLCAGILGDRQDACE 514

  Fly   309 GDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            ||||||:|.....:  ..|||:.|:|...|....| ..:|||:.|||||
Human   515 GDSGGPMVASFHGT--WFLVGLVSWGEGCGLLHNY-GVYTKVSRYLDWI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/242 (29%)
Tryp_SPc 123..359 CDD:238113 72/243 (30%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 72/242 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.