DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and LOC558805

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_021329158.1 Gene:LOC558805 / 558805 -ID:- Length:255 Species:Danio rerio


Alignment Length:262 Identity:72/262 - (27%)
Similarity:115/262 - (43%) Gaps:50/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYW----------CGGSLISDKHVITAAHCVDMA 171
            ::|:...||.|:.|        |...::...||.          |||.||...:|:|||||....
Zfish    15 SLALTGAFGADIIN--------GKKAKKSSLLYMASVQINGEHKCGGFLIDPSYVLTAAHCNKQG 71

  Fly   172 KRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQL 236
            ..: |.||.::| :.|.....|..|  :|..|:|::...:...||.:::|...|...:.:..:.:
Zfish    72 NMS-VILGTHDI-SPKGTNVKRYRV--QNKHIHPSYKSVKTGKDIMLLKLYKKVKIGKDVKLVTI 132

  Fly   237 PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI----- 296
            |.:....:. |:|..:| |||:  |......|.|....:..|:...|:|    .::..|:     
Zfish   133 PSKDKPLKP-KSKCLVA-GWGK--TEKDNTVNDLLVTDVLTINKTVCQS----VWKKINVELPDN 189

  Fly   297 --CTSGRNARS-TCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAA---FTKVASYLD 355
              |..|...:| .|.||||||||...:      .|||.|| ::..||  ||..   :|:::.|..
Zfish   190 ILCAGGYETKSGACQGDSGGPLVCSGQ------AVGIVSF-NMGRCD--YPNTPNIYTQISKYTH 245

  Fly   356 WI 357
            ||
Zfish   246 WI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/255 (27%)
Tryp_SPc 123..359 CDD:238113 71/256 (28%)
LOC558805XP_021329158.1 Tryp_SPc 26..250 CDD:238113 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.