DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and cela1.1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:259 Identity:77/259 - (29%)
Similarity:132/259 - (50%) Gaps:18/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLY--WCGGSLISDKHVITAAHCVDM 170
            |.|....|.....:|:.||::..||.:|:|:.:..| ..|.|  :|||:||....|:.||||||.
Zfish    15 LTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQYQ-SGGRYHHYCGGTLIRPGWVMVAAHCVDT 78

  Fly   171 AKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK--DDIAIVRLPHAVSFNERIHP 233
            ::...|.||.::....:...|   .:..:...|:|.|||..:.  :|||:::|....:.:..:..
Zfish    79 SRIWSVALGDHDTTTHEGPEQ---YISVKGVFIHPNWNPNIVANGNDIALLQLSINATLSSYVQV 140

  Fly   234 IQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSN--FPLSYRGTNI 296
            ..||. :.|...:.:...| :||||..|| .::|..|:...:.::|..||..:  :..:.:...|
Zfish   141 ATLPS-YGEILPYGHTCYI-TGWGRTQTG-GSLSAQLKQAYMPVVDHETCSQSDWWGSTVKDRMI 202

  Fly   297 CTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGY--PAAFTKVASYLDWIS 358
            |..|..:.|.|:||||.|  |....:.:.|:.|:|||.:..||:. |  |..||:|:.::.|::
Zfish   203 CAGGTTSMSACHGDSGSP--LNCLFNGEYVVHGVTSFVASSGCNT-YKKPTVFTRVSYHVSWLN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/242 (30%)
Tryp_SPc 123..359 CDD:238113 73/244 (30%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 73/241 (30%)
Tryp_SPc 30..265 CDD:238113 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.