DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and f2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:340 Identity:96/340 - (28%)
Similarity:145/340 - (42%) Gaps:65/340 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PAGLSTSSSSPFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREPLVLNLETTPLM 109
            |||.:|:.          ||......        |..|.|..:..|      .||..........
 Frog   297 PAGRTTTE----------EHQTFFDE--------KSFGSGEAVCGL------RPLFEQKSVEDKG 337

  Fly   110 EKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV------ 168
            ||.|.|..| ..||..|:...|...|:||.:..:.|:.|. ||.||:||:.|::||||:      
 Frog   338 EKELLESYM-QGRIVKGETAEPGSAPWQVMLFKKSPQELL-CGASLLSDRWVLSAAHCIFYPPWD 400

  Fly   169 ------DMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPK-RLKDDIAIVRLPHAVS 226
                  |:    ||.:| ...:...|:...|: ...|...::|.:|.| .|..|||:::|...|:
 Frog   401 KNYTTDDI----LVRIG-KHFRTKYERATERI-AQLERIIVHPKYNWKENLDRDIALIQLKRPVA 459

  Fly   227 FNERIHPIQLPKRHYEYR----SFKNKLAIASGWGR----YATGVHAISNVLRYVQLQIIDGRTC 283
            |:..|||:.||.:....:    .:|.::   :|||.    :.:|...:...|:.:.|.|:|..||
 Frog   460 FSNYIHPVCLPTKDTVVKLLAAGYKGRV---TGWGNLQETWTSGAQNLPQALQQINLPIVDQETC 521

  Fly   284 KSNFPLSYRGTNICTSGRNARST-----CNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGY 343
            ||:..:.......| :|.|...:     |.||||||.|::...:.:.|.:||.|:|.  ||||..
 Frog   522 KSSTNIKVTDNMFC-AGYNPEDSKRGDACEGDSGGPFVMKDPDTGRWVQLGIVSWGE--GCDRDN 583

  Fly   344 PAAF-TKVASYLDWI 357
            ...| ..|.....||
 Frog   584 KYGFYVHVHRMRKWI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 77/261 (30%)
Tryp_SPc 123..359 CDD:238113 78/262 (30%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527
Thrombin_light 303..349 CDD:370463 13/70 (19%)
Tryp_SPc 349..598 CDD:214473 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.