DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and f10

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:297 Identity:79/297 - (26%)
Similarity:133/297 - (44%) Gaps:30/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RHIKGLGMGREMSALSEEDDREPLVLNLETTPLMEKMLPE----GAMAMD------RIFGG-DVG 129
            ||:|   ..|..:.|.|.|.:.......|........|||    |...::      ||.|| :..
 Frog   174 RHMK---RERRETKLHENDKKNHTDSQNEVKMNQTGTLPERNVTGINILNPNDPNVRIVGGRECS 235

  Fly   130 NPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRL 194
            ...| |:|..::....:|  :|||:::|.:.::|||||::..|...|.:|....|.::....:..
 Frog   236 QGEC-PWQALLVSDEDEG--FCGGTILSREFILTAAHCMNQTKYFKVVVGELNTKISEGTESIHK 297

  Fly   195 MVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKL-AIASGWGR 258
            :   |...::|.:.......|||:::|..|::|.|.|.|..:|...:..:...|:. |:.||:||
 Frog   298 V---EKIIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACIPDPEFADQVLMNEPDAMVSGFGR 359

  Fly   259 -YATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS-GRNARSTCNGDSGGPLVLQRRH 321
             :..|..|  :.|:.:|:..|...:||.:...:......|.. ....:..|.||||||.|...:.
 Frog   360 IHERGRQA--STLQMLQVPYIKRHSCKESSTFAITENMFCAGFDTEVKDACQGDSGGPHVTPFKG 422

  Fly   322 SKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            :  ..:.||.|:|.  ||.| |....:|||:....|:
 Frog   423 T--YFVTGIVSWGE--GCARKGKFGVYTKVSKLHRWL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/239 (28%)
Tryp_SPc 123..359 CDD:238113 66/240 (28%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 66/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.