DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Mcpt9

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_062196.2 Gene:Mcpt9 / 54272 RGDID:3068 Length:248 Species:Rattus norvegicus


Alignment Length:255 Identity:77/255 - (30%)
Similarity:113/255 - (44%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MLP---EGAMAMDRIFGGDVGNPHCFPYQVGM-LLQRPKGLYWCGGSLISDKHVITAAHCVDMAK 172
            :||   ||.    .|..|....||..||...: .......|..|||.|::...|:|||||  ..:
  Rat    11 VLPVNTEGG----EILWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLVAKDIVMTAAHC--NGR 69

  Fly   173 RALVFLGANEIKNAKEKGQVRLMV---PSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI 234
            ...|.|||:.||. :|..||..::   |.|||      |...|.:||.:::|......|..:..|
  Rat    70 NIKVILGAHNIKK-RENTQVISVLKAKPHENF------NSDSLVNDIMLLKLERKAQLNGVVKTI 127

  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGT-NICT 298
            .||:.....:  ..::...:|||..|.  ..:||.|:.|.|::..|:.|: ....:|..: .:|.
  Rat   128 ALPRSQDWVK--PGQVCTVAGWGTLAN--CTLSNTLQEVNLEVQKGQKCQ-GMSRNYNDSIQLCV 187

  Fly   299 SGRNAR-STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            ...|.| :|..||||||.|.      ..|..||.|:..   |....|..||:::|::.||
  Rat   188 GNPNERKATAGGDSGGPFVC------NGVAQGIVSYRL---CTWTPPRVFTRISSFIPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/240 (30%)
Tryp_SPc 123..359 CDD:238113 73/241 (30%)
Mcpt9NP_062196.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.