DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:292 Identity:83/292 - (28%)
Similarity:133/292 - (45%) Gaps:61/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKML---PEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKH 160
            |.|.|.|.||:..::   |..||..:.|.||...:.:.:|:||.:.:.....:::||||||..:.
  Rat    39 LKLLLLTLPLLSSLVHAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQW 103

  Fly   161 VITAAHCVDMAKRALVFLGANEIKNAKEKGQVR---------LMVPSENFQIYPTWNPKRLKDDI 216
            |:||||||          |.|:....|.:.|:|         |:..|:... :|.:...:...||
  Rat   104 VLTAAHCV----------GPNKADPNKLRVQLRKQYLYYHDHLLTVSQIIS-HPDFYIAQDGADI 157

  Fly   217 AIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISN--------VLRYV 273
            |:::|.:.|:....:|.:.||.....:.|  ..|...:|||.       |:|        .|..|
  Rat   158 ALLKLTNPVNITSNVHTVSLPPASETFPS--GTLCWVTGWGN-------INNDVSLPPPFPLEEV 213

  Fly   274 QLQIIDGRTCKSNFPLSYRGTN------------ICTSGRNARSTCNGDSGGPLVLQRRHSKKRV 326
            |:.|::.|.|...:   ::|.|            :| :|.....:|.||||||||.:...:  .:
  Rat   214 QVPIVENRLCDLKY---HKGLNTGDNVHIVRDDMLC-AGNEGHDSCQGDSGGPLVCKVEDT--WL 272

  Fly   327 LVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            ..|:.|:|.  ||.: ..|..:|:|..|||||
  Rat   273 QAGVVSWGE--GCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/264 (27%)
Tryp_SPc 123..359 CDD:238113 74/265 (28%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 72/263 (27%)
Tryp_SPc 66..302 CDD:238113 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.