DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and PLAU

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:373 Identity:94/373 - (25%)
Similarity:155/373 - (41%) Gaps:80/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPGPAGLSTSSSS--PFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREP---LVL 101
            |.|.|...|....  |::|:..|:.......|:.     ..||:|:.....:.::.|.|   :.:
Human    78 YRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDA-----LQLGLGKHNYCRNPDNRRRPWCYVQV 137

  Fly   102 NLETTPLMEKMLPEGAMAMD---------------------------RIFGGDVGNPHCFPYQVG 139
            .|       |:|.:..|..|                           :|.||:.......|: ..
Human   138 GL-------KLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPW-FA 194

  Fly   140 MLLQRPKG---LYWCGGSLISDKHVITAAHC-VDMAKRA--LVFLGANEIKNAKEKGQVRLMVPS 198
            .:.:|.:|   .|.|||||||...||:|.|| :|..|:.  :|:||.:.: |:..:|:::..|  
Human   195 AIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRL-NSNTQGEMKFEV-- 256

  Fly   199 ENFQIYPTWNPKRL--KDDIAIVRL----PHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWG 257
            ||..::..::...|  .:|||::::    ......:..|..|.||.. |....|.....| :|:|
Human   257 ENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSM-YNDPQFGTSCEI-TGFG 319

  Fly   258 RYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNA------RSTCNGDSGGPLV 316
            :..:..:.....|:...:::|..|.|:..   .|.|:.:.|....|      ..:|.||||||||
Human   320 KENSTDYLYPEQLKMTVVKLISHRECQQP---HYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLV 381

  Fly   317 --LQRRHSKKRVLVGITSFGSIYGCD-RGYPAAFTKVASYLDWISDET 361
              ||.|    ..|.||.|:|.  ||. :..|..:|:|:.:|.||...|
Human   382 CSLQGR----MTLTGIVSWGR--GCALKDKPGVYTRVSHFLPWIRSHT 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/255 (29%)
Tryp_SPc 123..359 CDD:238113 75/256 (29%)
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 18/85 (21%)
Connecting peptide 152..177 0/24 (0%)
Tryp_SPc 179..422 CDD:238113 75/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.