DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss33

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:259 Identity:83/259 - (32%)
Similarity:124/259 - (47%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRAL-----VFLGA- 180
            ||.||.......:|:|..:   :.:|.:.||||||:.:.|:||.||  .::|.|     |.||| 
  Rat    33 RIVGGRDAQDGEWPWQTSI---QHRGAHVCGGSLIAPQWVLTAGHC--FSRRVLPSEYSVLLGAL 92

  Fly   181 -NEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPK--RHYE 242
             .::.::.|     |:||.....:.|.::....:.|:|:::|.|.||.:.||.|:.||.  .|..
  Rat    93 SLDVTSSHE-----LLVPVLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPVCLPAPGSHPP 152

  Fly   243 YRSFKNKLAIASGWGRYATGVH-AISNVLRYVQLQIIDGRTCK------SNFPLSYR---GTNIC 297
                .......:|||..:.||. .....|:.|::.::|.|.|.      :|.|.|.|   ..|:|
  Rat   153 ----PGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERIVLPGNLC 213

  Fly   298 TSGRNA-RSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC---DRGYPAAFTKVASYLDWI 357
            ...|.. :..|.|||||||...  .|.:.||||:.|:|.  ||   :|  |..:|.||.|..||
  Rat   214 AGYRRGHKDACQGDSGGPLTCM--ESGRWVLVGVVSWGK--GCALPNR--PGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 81/257 (32%)
Tryp_SPc 123..359 CDD:238113 82/258 (32%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 81/257 (32%)
Tryp_SPc 34..272 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.