DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and MST1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:356 Identity:92/356 - (25%)
Similarity:144/356 - (40%) Gaps:66/356 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PAGLSTSSSSPFSSSGSLEHDAEMSASNVDN--RHIKGLGMGREMSALSEEDDREPLVLNLETTP 107
            ||.:|::|:.|.....|  ..:.:..:.:.|  |...|..||..|...:....:.|   :..|.|
Human   398 PARVSSASAGPLRRRTS--RSSRLPPNRMHNWRRTSAGTQMGIAMGPGATRWTQGP---HSTTVP 457

  Fly   108 ----LM----EKMLPEGAMAMDRIFGGDV----GNPHC---------FPYQ----VGMLLQRP-- 145
                ||    :...|:...::..:..|.:    |.|.|         .|.|    :|. .|.|  
Human   458 CDAALMTSRHQSWTPQTRCSLRSVARGWIGWISGVPSCAWLGAIRATHPGQSACGIGE-AQLPVS 521

  Fly   146 ------KGLYWCGGSLISDKHVITAAHCVDMAKRAL----VFLGANEIKNAKEKGQVRLM-VPSE 199
                  :|.::|||||:.::.::||..|.......|    |:||.  :....:.|:..|. ||..
Human   522 HREELRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT--LFQNPQHGEPSLQRVPVA 584

  Fly   200 NFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGR-YATGV 263
            .....|:.:      .:.:::|..:|:.|:|:..|.||...|.... ..|..|| |||. ..||.
Human   585 KMVCGPSGS------QLVLLKLERSVTLNQRVALICLPPEWYVVPP-GTKCEIA-GWGETKGTGN 641

  Fly   264 HAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNAR-STCNGDSGGPLVLQRRHSKKRVL 327
            ..:.||   ..|.:|..:.|........|.:.:||.|..|. ..|.||.||||.....:.  .||
Human   642 DTVLNV---ALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNC--WVL 701

  Fly   328 VGITSFGSIYGCDRG-YPAAFTKVASYLDWI 357
            .||.....:  |.|. :||.||:|:.::|||
Human   702 EGIIIPNRV--CARSRWPAVFTRVSVFVDWI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/267 (27%)
Tryp_SPc 123..359 CDD:238113 74/268 (28%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.