DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and cela1.6

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:269 Identity:93/269 - (34%)
Similarity:138/269 - (51%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYW--CGGSLISDKHVITAA 165
            |....|.|....|..:|.:|:.||:|..|:.:|:|:. |.....|.|:  |||:||....|:|||
Zfish    10 LAALALAEPRYLEEQIAQERVVGGEVARPNSWPWQIS-LQYLSGGSYYHTCGGTLIKQNFVLTAA 73

  Fly   166 HCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKD--DIAIVRLPHAVSFN 228
            ||||.::...|.||.::|  .|::|:.:.|..| |..|:|.||...:..  |||::||....|.|
Zfish    74 HCVDTSRTWRVVLGEHDI--YKQEGREQYMTVS-NVYIHPNWNRNNVAAGYDIALLRLSSNASLN 135

  Fly   229 ERIHPIQLPKR-----HYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSN-- 286
            ..:....||..     |       |.....:|||..:|| .::|..|:...|.::|..||...  
Zfish   136 TYVQLGTLPPSGQVLPH-------NNACYITGWGLTSTG-GSLSAQLKQAYLPVVDYNTCSRGDW 192

  Fly   287 FPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGY--PAAFTK 349
            :..:.:.|.:|..| .:.|.|.|||||||..|  .|.:.|:.|:|||.|..||: .|  |..||:
Zfish   193 WGSTVKNTMVCAGG-GSLSGCQGDSGGPLNCQ--VSGQYVVHGVTSFVSSSGCN-AYQKPTVFTR 253

  Fly   350 VASYLDWIS 358
            |::|:.||:
Zfish   254 VSAYISWIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 86/247 (35%)
Tryp_SPc 123..359 CDD:238113 87/249 (35%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 87/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.