DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and cela1.3

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:263 Identity:89/263 - (33%)
Similarity:130/263 - (49%) Gaps:15/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGM-LLQRPKGLYWCGGSLISDKHVITAAH 166
            |.|..|.|....|......|:.||:|..|:.:|:|:.: .|......:.||||||....|:||||
Zfish    25 LATLVLAEPRYLEDIDIEGRVVGGEVAKPNSWPWQISLQYLSGSSYYHTCGGSLIRPGWVMTAAH 89

  Fly   167 CVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKD--DIAIVRLPHAVSFNE 229
            |||..:...|.||.::|.|.:.:.|   .:......|:|.||...|..  |||::.|....|.|.
Zfish    90 CVDSPRTWRVVLGDHDIYNHEGREQ---YISVSRAHIHPNWNSNSLSSGYDIALLELSSDASLNS 151

  Fly   230 RIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSN--FPLSYR 292
            .:....||.......:  |.....|||||..|| .::|..|:...|.::|..||..:  :..:.:
Zfish   152 YVQLAALPPSGQVLPN--NNPCYISGWGRTQTG-GSLSAELKQAYLPVVDHDTCSRSDWWGSTVK 213

  Fly   293 GTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRG-YPAAFTKVASYLDW 356
            .|.|| .|....:.|:|||||||..|  .|.:.|:.|:|||.|..||:.. .|..|::|::|:.|
Zfish   214 NTMIC-GGDGTLAGCHGDSGGPLNCQ--VSGQYVVHGVTSFVSSAGCNTNKRPTVFSRVSAYISW 275

  Fly   357 ISD 359
            |:|
Zfish   276 IND 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 81/240 (34%)
Tryp_SPc 123..359 CDD:238113 82/241 (34%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.