DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:258 Identity:94/258 - (36%)
Similarity:134/258 - (51%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EKMLP---EGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMA 171
            :|::|   :......||..|........||.||:|.. ..|.:|||||:|.:..|:|||||.:.|
  Fly    22 QKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFS-GNGNWWCGGSIIGNTWVLTAAHCTNGA 85

  Fly   172 KRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQL 236
            ....:..||    :.:.:.|....|.|.||..:..:|...|.:||:::|.|| |.|...::.::|
  Fly    86 SGVTINYGA----SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVEL 145

  Fly   237 PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGR 301
            |..:..|:.:....|:|||||....| ..:.:.|:.|.:||:....|...:  |.....||.:..
  Fly   146 PSYNDRYQDYAGWWAVASGWGGTYDG-SPLPDWLQAVDVQIMSQSDCSRTW--SLHDNMICINTN 207

  Fly   302 NARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVS 364
            ..:|||.||||||||   .|...| |||:|||.|..||..|.||.|::|..|||||.|.||:|
  Fly   208 GGKSTCGGDSGGPLV---THEGNR-LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGIS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 86/234 (37%)
Tryp_SPc 123..359 CDD:238113 87/235 (37%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 86/234 (37%)
Tryp_SPc 38..262 CDD:238113 87/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470952
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.